PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1698980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 596aa    MW: 65609.1 Da    PI: 4.4324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1698980.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1531.4e-4751321127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyat.gkrknratksgyWkatgkdke 91 
                      l pGfrFhPtdeelv +yLk++v+g+ ++  + i  vd+yk+ePwdLp  +k+k+++ ewyf+s  dkky + ++r+nrat++gyWk+tgkd++
  Lj5g3v1698980.1   5 LSPGFRFHPTDEELVGFYLKRRVTGRLFHG-DPIGIVDVYKYEPWDLPclSKMKTRDLEWYFYSGLDKKYGKgSSRTNRATEKGYWKTTGKDRP 97 
                      579************************999.89***************6448888999*************94569****************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      v +  +++vg+kktLv++ grap+g +t+Wvmheyr
  Lj5g3v1698980.1  98 VNH-ANRTVGMKKTLVYHFGRAPTGARTNWVMHEYR 132
                      ***.8999***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-543156IPR003441NAC domain
PROSITE profilePS5100552.8335156IPR003441NAC domain
PfamPF023658.2E-267132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MSSNLSPGFR FHPTDEELVG FYLKRRVTGR LFHGDPIGIV DVYKYEPWDL PCLSKMKTRD  60
LEWYFYSGLD KKYGKGSSRT NRATEKGYWK TTGKDRPVNH ANRTVGMKKT LVYHFGRAPT  120
GARTNWVMHE YRSVDEVLAQ SGVAQDAYVL CRIFEKSGAG PKNGEKYGAP LIEEEWDNFD  180
MISPLAAFGD EYINEVPDVD GLLETKDLDQ DQDQKHVAPL APLAVVDDKL MNGVLDDGDF  240
METNDLDKKL DMPAVAIGSA DFPSNFHYGE CSSLPEYSQA FISDRKLLED TMGNSGPENH  300
QPFNMAQQYG ADTNAGNDGG DTGELSYDEK PLNFDCLDSL AQGLNPNWSP LNLDEILETD  360
DLANLAEGNP AEADSSVIGM VDEYLSYTED DIYKYICFDS PGNEGSEIAI PDQGPQPIQQ  420
NVEVETRDIS VASKPVFEAQ SSNEASLKQH VHQTSKFVSE DSNPIVKHAH KLLASMPAPP  480
AFASEFPTKG FALGLHPGAQ SSNTTHIAGM ISITDITLRG NAMDWMVGKN GGFNATIMSS  540
GFSQSDFNSD SLMPISDLVS SKTTCVLSHG CLYLMGFSVL ILSLSFKIGS YMYTAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-42415614168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.73580.0cell culture| floral bud| pod| protoplast| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105230.0AP010523.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT23O16, TM1810, complete sequence.
GenBankAP0105240.0AP010524.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT34P16, TM1824, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496133.10.0PREDICTED: NAC domain-containing protein 53 isoform X1
TrEMBLA0A072VMT50.0A0A072VMT5_MEDTR; NAC transcription factor-like protein
STRINGGLYMA20G33390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.14e-85NAC domain containing protein 2